Pfam domain
Pfam family: TIG_SUH (PF20144.1)
Uniprot AC: Q06330
RecName: Recombining binding protein suppressor of hairless
Begin-End: 354-444
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFRE
GWRWVRQPVQVPVTLVRNDGIIYSTSLTFTY
Structures of the domain Q06330 354-444
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2f8x X-ray 3.25 C 340-430 None
3nbn X-ray 3.45 D 340-430 None
3nbn X-ray 3.45 A 340-430 None
3v79 X-ray 3.85 C 340-430 None
6py8 X-ray 3.75 E 340-430 None
6py8 X-ray 3.75 C 340-430 None


© NPIDB team 2003 - 2021

text