Pfam domain
Pfam family: LAG1-DNAbind (PF09271.13)
Uniprot AC: Q06330
RecName: Recombining binding protein suppressor of hairless
Begin-End: 48-178
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGN
SDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKP
SKKKQSLKNAD
Structures of the domain Q06330 48-178
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2f8x X-ray 3.25 C 34-164  L-Bb L-Mj 
3nbn X-ray 3.45 D 34-164  L-Bb L-Mj 
3nbn X-ray 3.45 A 34-164  L-Bb L-Mj 
3v79 X-ray 3.85 C 34-164  L-Bb L-Mj 
6py8 X-ray 3.75 E 34-164  L-Bb L-Mj 
6py8 X-ray 3.75 C 34-164  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text