Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q06406
RecName: U6 snRNA-associated Sm-like protein LSm6
Begin-End: 14-83
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFL
RGTQVMYISE
Structures of the domain Q06406 14-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vsu X-ray 3.1 F 14-82 None
4m7a X-ray 2.78 K 14-82 None
4m7a X-ray 2.78 D 14-82 None
4m7a X-ray 2.78 K 14-82 None
4m7a X-ray 2.78 D 14-82 None
4m7d X-ray 2.6 K 14-82 None
4m7d X-ray 2.6 D 14-82 None
3jcm X-ray 3.8 e 14-82 None


© NPIDB team 2003 - 2019

text