Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: Q06453
RecName: Homeobox protein aristaless
Begin-End: 86-142
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
RRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRK
Structures of the domain Q06453 86-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3a01 X-ray 2.7 B 86-142  H-Bb H-Mj L-Bb 
3a01 X-ray 2.7 F 86-142  H-Bb H-Mj L-Bb 
3lnq X-ray 2.25 A 87-142  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text