Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: Q06796
RecName: 50S ribosomal protein L11
Begin-End: 2-66
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
AKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEISVY
EDRSF
Structures of the domain Q06796 2-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 6 9-66 None
3j3w X-ray 10.7 6 9-66 None


© NPIDB team 2003 - 2019

text