Pfam domain
Pfam family: DIM1 (PF02966.15)
Uniprot AC: Q06819
RecName: Spliceosomal protein DIB1
Begin-End: 5-137
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDI
DEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGA
RKNKGLVVSPYDY
Structures of the domain Q06819 5-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcm X-ray 3.8 L 5-137 None
5gap X-ray 3.6 D 5-137 None


© NPIDB team 2003 - 2020

text