Pfam domain
Pfam family: HMG_box (PF00505.18)
Uniprot AC: Q06831
RecName: Transcription factor SOX-4
Begin-End: 59-127
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
IKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIQEAERLRLK
HMADYPDYK
Structures of the domain Q06831 59-127
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3u2b X-ray 2.4 C 3-71  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2019

text