Pfam domain
Pfam family: Zn-ribbon_8 (PF09723.12)
Uniprot AC: Q07230
RecName: Zinc finger and SCAN domain-containing protein 2
Begin-End: 262-304
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
GSNFSRHQTTHTGEKPYKCRDCGKSFSRSANLITHQRIHTGEK
Structures of the domain Q07230 262-304
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2i13 X-ray 1.96 A 77-119  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text