Pfam domain
Pfam family: AARP2CN (PF08142.11)
Uniprot AC: Q07381
RecName: Ribosome biogenesis protein TSR1
Begin-End: 234-309
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DALNVLRTLCQRLPRSINWRDNRGYVVADFVDFVETSPDSGDLVIEGTVRGIGFNANRLV
HIPDFGDFQLNKIEKI
Structures of the domain Q07381 234-309
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 k 235-309 None
6eml X-ray 3.6 t 235-309 None


© NPIDB team 2003 - 2019

text