Pfam domain
Pfam family: RIBIOP_C (PF04950.11)
Uniprot AC: Q07381
RecName: Ribosome biogenesis protein TSR1
Begin-End: 486-779
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IELEPSESAIERLKRYRGLKNLYNCDWQVDEKDPSSPAEWKRLLRIGNYKNTKNRIIKET
KNEAQAIAGDRIRMFIRFPKFLLEKIQDPKQLLFAVYGLLLHEHKNAVVNFSLQRWEQYD
KPVPSQEPIVVQYGVRRYTIQPLFSQGSNSPNNVHKYERFLHPDTVSVATCIAPVDFTQS
PAIFFKPSPTDAKNIELIGHGTFLNADHSRILAKRAILTGHPFRFHKTVVTVRYMFFRPE
DVEWFKSIPLFTKSGRSGFIKESLGTHGYFKATFDGKLSAQDVVAMSLYKRMWP
Structures of the domain Q07381 486-779
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 k 486-779 None
6eml X-ray 3.6 t 486-779 None


© NPIDB team 2003 - 2019

text