Pfam domain
Pfam family: TIG (PF01833.23)
Uniprot AC: Q07802
RecName: Transcription factor COE1
Begin-End: 262-344
Organism: Mus musculus
Interaction Mode:   

Sequence:
PCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPG
VVEVTLSYKSKQFCKGTPGRFIY
Structures of the domain Q07802 262-344
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3mlp X-ray 2.8 B 255-337 None
3mlp X-ray 2.8 A 255-337 None
3mlp X-ray 2.8 F 255-337 None
3mlp X-ray 2.8 E 255-337 None


© NPIDB team 2003 - 2020

text