Pfam domain
Pfam family: COE1_DBD (PF16422.4)
Uniprot AC: Q07802
RecName: Transcription factor COE1
Begin-End: 27-235
Organism: Mus musculus
Interaction Mode:   

Sequence:
VRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIER
TAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDK
NPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPR
DMRRFQVVVSTTVNVDGHVLAVSDNMFVH
Structures of the domain Q07802 27-235
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3mln X-ray 2.4 E 27-235 None


© NPIDB team 2003 - 2019

text