Pfam domain
Pfam family: COE1_DBD (PF16422.4)
Uniprot AC: Q07802
RecName: Transcription factor COE1
Begin-End: 35-241
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
GVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVE
KEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVL
LTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVV
VSTTVNVDGHVLAVSDNMFVHNNSKHG
Structures of the domain Q07802 35-241
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3mlo X-ray 3.01 B 36-242  H-Bb S-Mj L-Bb L-Mj L-Mn 
3mlo X-ray 3.01 A 36-242  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
3mln X-ray 2.4 B 36-242 None
3mln X-ray 2.4 A 36-240 None
3mlp X-ray 2.8 F 36-252  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
3mlp X-ray 2.8 B 36-253 None


© NPIDB team 2003 - 2019

text