Pfam domain
Pfam family: COE1_DBD (PF16422.4)
Uniprot AC: Q07802
RecName: Transcription factor COE1
Begin-End: 36-247
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
VLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEK
EKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLL
THEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVV
STTVNVDGHVLAVSDNMFVHNNSKHGRRARRL
Structures of the domain Q07802 36-247
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3mlp X-ray 2.8 E 36-247  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
3mlp X-ray 2.8 A 36-247 None


© NPIDB team 2003 - 2019

text