Pfam domain
Pfam family: CBF (PF03914.16)
Uniprot AC: Q07896
RecName: Nucleolar complex-associated protein 3
Begin-End: 472-647
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ALLCIVSAFSLISNTQYMKVNVDLSKFVDGLYALLPYICLDADIELSYRSLRLADPLNNE
IIKPSVNVSTKAELLLKALDHVFFRSKSGTKERATAFTKRLYMCISHTPEKTSIAILKFI
DKLMNRYPEISGLYSSEDRIGNGHFIMEADNPSRSNPEAATLWDNALLEKHYCPVV
Structures of the domain Q07896 472-647
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 I 473-630 None


© NPIDB team 2003 - 2019

text