Pfam domain
Pfam family: Ribosomal_L24e (PF01246.19)
Uniprot AC: Q07915
RecName: Ribosome biogenesis protein RLP24
Begin-End: 2-66
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAGK
ELAVD
Structures of the domain Q07915 2-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 u 1-64 None
6em5 X-ray 4.3 u 11-74 None


© NPIDB team 2003 - 2019

text