Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: Q08050
RecName: Forkhead box protein M1
Begin-End: 235-319
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDM
FVRETSANGKVSFWTIHPSANRYLT
Structures of the domain Q08050 235-319
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3g73 X-ray 2.21 B 236-316  H-Bb H-Mj S-Bb L-Bb 
3g73 X-ray 2.21 A 236-316  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2020

text