Pfam domain
Pfam family: Brix (PF04427.17)
Uniprot AC: Q08235
RecName: Ribosome biogenesis protein BRX1
Begin-End: 38-224
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SRGVNYRHRHLIQDLSGLLPHSRKEPKLDTKKDLQQLNEIAELYNCNNVLFFEARKHQDL
YLWLSKPPNGPTIKFYIQNLHTMDELNFTGNCLKGSRPVLSFDQRFESSPHYQLIKELLV
HNFGVPPNARKSKPFIDHVMSFSIVDDKIWVRTYEISHSTKNKEEYEDGEEDISLVEIGP
RFVMTVI
Structures of the domain Q08235 38-224
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 A 38-223 None


© NPIDB team 2003 - 2019

text