Pfam domain
Pfam family: GAGA (PF09237.13)
Uniprot AC: Q08605
RecName: Transcription factor GAGA
Begin-End: 319-372
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
Structures of the domain Q08605 319-372
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1yui NMR A 10-63  H-Bb H-Mj L-Bb L-Mj L-Mn 
1yuj NMR A 10-63  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text