Pfam domain
Pfam family: AFT (PF08731.10)
Uniprot AC: Q08957
RecName: Iron-regulated transcriptional activator AFT2
Begin-End: 51-89
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
FEDRHEIKPWLQKIFYPQGIDIVIERSDSSKVTFKCRSV
Structures of the domain Q08957 51-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4lmg X-ray 2.2 A 51-89  H-Bb S-Bb S-Mj L-Bb 
4lmg X-ray 2.2 D 51-88  H-Bb S-Bb S-Mj L-Bb 
4lmg X-ray 2.2 B 51-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4lmg X-ray 2.2 C 51-89  H-Bb S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2019

text