Pfam domain
Pfam family: UPF0113 (PF03657.12)
Uniprot AC: Q08962
RecName: 60S ribosome subunit biogenesis protein NIP7
Begin-End: 96-174
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KIWIKPNGEMPFLYGNHVLKAHVGKMSDDIPEHAGVIVFAMNDVPLGFGVSAKSTSESRN
MQPTGIVAFRQADIGEYLR
Structures of the domain Q08962 96-174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 l 8-174 None


© NPIDB team 2003 - 2019

text