Pfam domain
Pfam family: Activator_LAG-3 (PF11498.7)
Uniprot AC: Q09260
RecName: Protein lag-3
Begin-End: 52-114
Organism: Caenorhabditis elegans
Interaction Mode:   

Sequence:
EDEPTIGDLNAFHSGEELHRQRSELARANYEKARPEMIANQRAVTAHLFNRYTEDEERKR
VEQ
Structures of the domain Q09260 52-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2fo1 X-ray 3.12 D 52-114 None


© NPIDB team 2003 - 2020

text