Pfam domain
Pfam family: Sigma70_ner (PF04546.15)
Uniprot AC: Q0P6L9
RecName: RNA polymerase sigma factor RpoD
Begin-End: 137-348
Organism: Escherichia coli
Interaction Mode:   

Sequence:
YPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATHVGSELSQEDLDDDEDE
DEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVF
KQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWF
NAAIAMNKPWSEKLHDVSEEVHRALQKLQQIE
Structures of the domain Q0P6L9 137-348
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n62 X-ray 3.8 F 167-348 None
6wmu X-ray 3.18 F 167-348 None


© NPIDB team 2003 - 2021

text