Pfam domain
Pfam family: RuvC_III (PF18541.3)
Uniprot AC: Q0P897
RecName: CRISPR-associated endonuclease Cas9
Begin-End: 504-576
Organism: Campylobacter jejuni subsp. jejuni serotype O:2
Interaction Mode:   

Sequence:
AKKDAELECEKLGLKINSKNILKLRLFKEQKEFCAYSGEKIKISDLQDEKMLEIDHIYPY
SRSFDDSYMNKVL
Structures of the domain Q0P897 504-576
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x2h X-ray 2.3 A 695-813 None


© NPIDB team 2003 - 2021

text