Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q10163
RecName: Small nuclear ribonucleoprotein-associated protein B
Begin-End: 4-80
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
TKMVSLLNHSLNVTTKDGRTFVGQLLAFDGFMNLVLSDCQEYRHIKKQNVPSNSVYEEKR
MLGLVILRGEFIVSLSV
Structures of the domain Q10163 4-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 b 72-133 None
3jb9 X-ray 3.6 E 7-68 None


© NPIDB team 2003 - 2019

text