Pfam domain
Pfam family: CPSF_A (PF03178.14)
Uniprot AC: Q10570
RecName: Cleavage and polyadenylation specificity factor subunit 1
Begin-End: 1073-1409
Organism: Homo sapiens
Interaction Mode:   

Sequence:
AFSIQLISPVSWEAIPNARIELQEWEHVTCMKTVSLRSEETVSGLKGYVAAGTCLMQGEE
VTCRGRILIMDVIEVVPEPGQPLTKNKFKVLYEKEQKGPVTALCHCNGHLVSAIGQKIFL
WSLRASELTGMAFIDTQLYIHQMISVKNFILAADVMKSISLLRYQEESKTLSLVSRDAKP
LEVYSVDFMVDNAQLGFLVSDRDRNLMVYMYLPEAKESFGGMRLLRRADFHVGAHVNTFW
RTPCRGATEGLSKKSVVWENKHITWFATLDGGIGLLLPMQEKTYRRLLMLQNALTTMLPH
HAGLNPRAFRMLHVDRRTLQNAVRNVLDGELLNRYLY
Structures of the domain Q10570 1073-1409
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fbs X-ray 3.07 A 1074-1408 None
6fuw X-ray 3.07 A 1074-1408 None


© NPIDB team 2003 - 2019

text