Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: Q12024
RecName: Ribosome biogenesis protein YTM1
Begin-End: 95-131
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SYLNSFSNEDWVSSLDVGDGSKHIISGSYDGIVRTWD
Structures of the domain Q12024 95-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 p 51-87 None


© NPIDB team 2003 - 2019

text