Pfam domain
Pfam family: HRDC (PF00570.25)
Uniprot AC: Q12149
RecName: Exosome complex exonuclease RRP6
Begin-End: 438-505
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
REVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTNGVTEHVRQN
AKLLANLI
Structures of the domain Q12149 438-505
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4oo1 X-ray 3.3 J 438-505 None
5c0w X-ray 4.6 K 438-505 None
5c0y X-ray 2.1 B 438-505 None
5c0y X-ray 2.1 A 438-505 None
5vzj X-ray 3.3 J 438-505 None
5k36 X-ray 3.1 J 438-505 None


© NPIDB team 2003 - 2021

text