Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q12330
RecName: Small nuclear ribonucleoprotein E
Begin-End: 19-92
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLG
KILLKGDNITLITS
Structures of the domain Q12330 19-92
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 G 19-91 None
5wsg X-ray 4 i 19-91 None
5gmk X-ray 3.4 u 19-91 None
5gmk X-ray 3.4 i 101-183 None
6bk8 X-ray 3.3 c 19-91 None
6bk8 X-ray 3.3 l 19-91 None
5lj3 X-ray 3.8 p 16-91 None
5lj3 X-ray 3.8 e -7-91 None
5mps X-ray 3.85 e -7-91 None
5lj5 X-ray 3.8 p 19-91 None
5lj5 X-ray 3.8 e 19-91 None
3jcm X-ray 3.8 Y 19-91 None
3jcm X-ray 3.8 V 19-91 None
5gam X-ray 3.7 e 19-91 None
5uz5 X-ray 3.56 O 19-91 None
5gao X-ray 3.6 p 19-91 None


© NPIDB team 2003 - 2019

text