Pfam domain
Pfam family: eIF-6 (PF01912.17)
Uniprot AC: Q12522
RecName: Eukaryotic translation initiation factor 6
Begin-End: 4-204
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIGRMT
AGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPDIDR
ETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVPLVA
GTVNRGSSVVGAGMVVNDYLA
Structures of the domain Q12522 4-204
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 y 5-202 None
6em5 X-ray 4.3 y 4-202 None
2x7n X-ray 11.8 B 4-202 None


© NPIDB team 2003 - 2019

text