Pfam domain
Pfam family: Ribosomal_L13e (PF01294.17)
Uniprot AC: Q12690
RecName: 60S ribosomal protein L13-A
Begin-End: 21-128
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVVRAPTVKYNRKVRAGRGFTLAEV
KAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQSKIIVFPR
Structures of the domain Q12690 21-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 L 22-129 None
6em3 X-ray 3.2 L 22-129 None


© NPIDB team 2003 - 2019

text