Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: Q12778
RecName: Forkhead box protein O1
Begin-End: 161-244
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
GNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLH
SKFIRVQNEGTGKSSWWMLNPEGG
Structures of the domain Q12778 161-244
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3co6 X-ray 2.1 C 162-242  H-Bb H-Mj S-Bb L-Bb 
4lg0 X-ray 2.19 A 162-242  H-Bb H-Mj S-Bb L-Bb L-Mj 
3co7 X-ray 2.91 F 162-241  H-Bb H-Mj S-Bb L-Bb 
3co7 X-ray 2.91 C 162-241 None
3coa X-ray 2.2 C 162-241  H-Bb H-Mj S-Bb L-Bb 
3coa X-ray 2.2 F 162-241 None
5dui X-ray 2.31 B 162-242  H-Bb H-Mj 
5dui X-ray 2.31 A 162-242  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2020

text