Pfam domain
Pfam family: Ribosomal_L28 (PF00830.18)
Uniprot AC: Q13084
RecName: 39S ribosomal protein L28, mitochondrial
Begin-End: 76-138
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLI
DEA
Structures of the domain Q13084 76-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 X 88-136 None
5oom X-ray 3.03 X 88-136 None


© NPIDB team 2003 - 2019

text