Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: Q13148
RecName: TAR DNA-binding protein 43
Begin-End: 106-172
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR
HMIDGRW
Structures of the domain Q13148 106-172
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4iuf X-ray 2.75 A 106-168 None
4y00 X-ray 3 C 106-170 None
4y00 X-ray 3 B 106-170 None
4y00 X-ray 3 A 106-170 None
4y00 X-ray 3 D 106-170 None
4bs2 NMR A 106-166 None
4y0f X-ray 2.65 B 106-168 None
4y0f X-ray 2.65 A 106-168 None


© NPIDB team 2003 - 2019

text