Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: Q13148
RecName: TAR DNA-binding protein 43
Begin-End: 193-243
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSL
Structures of the domain Q13148 193-243
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4bs2 NMR A 193-241 None


© NPIDB team 2003 - 2019

text