Pfam domain
Pfam family: B56 (PF01603.22)
Uniprot AC: Q13362
RecName: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
Begin-End: 30-372
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITE
PIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPD
FQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFY
RFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAY
CVVQFLEKDSTLTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFR
QLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFP
Structures of the domain Q13362 30-372
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6voy X-ray 3.7 F 31-372 None
6voy X-ray 3.7 E 31-372 None


© NPIDB team 2003 - 2021

text