Pfam domain
Pfam family: AAA (PF00004.31)
Uniprot AC: Q13415
RecName: Origin recognition complex subunit 1
Begin-End: 530-675
Organism: Homo sapiens
Interaction Mode:   

Sequence:
MYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTG
QKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVV
LAIANTMDLPERIMMNRVSSRLGLTR
Structures of the domain Q13415 530-675
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jps X-ray 4.4 A 530-686  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text