Pfam domain
Pfam family: AAA_lid_10 (PF17872.3)
Uniprot AC: Q13415
RecName: Origin recognition complex subunit 1
Begin-End: 674-737
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDARRCLDICRRATEIC
EFSQ
Structures of the domain Q13415 674-737
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jps X-ray 4.4 A 660-746 None


© NPIDB team 2003 - 2021

text