Pfam domain
Pfam family: Cdc6_C (PF09079.13)
Uniprot AC: Q13415
RecName: Origin recognition complex subunit 1
Begin-End: 778-857
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPS
RNDLLLRVRLNVSQDDVLYA
Structures of the domain Q13415 778-857
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jps X-ray 4.4 A 778-857 None


© NPIDB team 2003 - 2021

text