Pfam domain
Pfam family: ORC2 (PF04084.16)
Uniprot AC: Q13416
RecName: Origin recognition complex subunit 2
Begin-End: 268-466
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFR
TTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLE
LFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYE
TTTYSPYTEETSYENSLLV
Structures of the domain Q13416 268-466
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jps X-ray 4.4 B 268-466  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text