Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: Q13469
RecName: Nuclear factor of activated T-cells, cytoplasmic 2
Begin-End: 410-570
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
LRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILK
PHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELR
KGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECS
Structures of the domain Q13469 410-570
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1owr X-ray 3 Q 410-570  H-Bb S-Bb L-Bb L-Mj 
1owr X-ray 3 P 410-570  H-Bb S-Bb L-Bb L-Mj 
1owr X-ray 3 N 410-570  H-Bb S-Bb S-Mj L-Bb L-Mj 
1owr X-ray 3 M 410-570  H-Bb S-Bb L-Bb L-Mj 
1pzu X-ray 3.1 M 410-570  H-Bb S-Bb L-Bb L-Mj L-Mn 
1pzu X-ray 3.1 L 410-570  H-Bb S-Bb L-Bb L-Mj 
1pzu X-ray 3.1 I 410-570  H-Bb S-Bb L-Bb L-Mj L-Mn 
1pzu X-ray 3.1 H 410-570  H-Bb S-Bb L-Bb L-Mj 
1pzu X-ray 3.1 D 410-570  H-Bb S-Bb L-Bb L-Mj 
1pzu X-ray 3.1 B 410-570  H-Bb S-Bb L-Bb L-Mj 
1s9k X-ray 3.1 C 410-570  H-Bb S-Bb L-Bb L-Mj 
1p7h X-ray 2.6 N 410-570  H-Bb S-Bb L-Bb L-Mj 
1p7h X-ray 2.6 O 410-570  H-Bb S-Bb L-Bb L-Mj 
1p7h X-ray 2.6 L 410-570 None
1p7h X-ray 2.6 M 410-570 None
2as5 X-ray 2.7 N 410-570  H-Bb S-Bb S-Mj L-Bb L-Mj 
2as5 X-ray 2.7 M 410-570  H-Bb S-Bb L-Bb L-Mj 
1a02 X-ray 2.7 N 410-570  H-Bb S-Bb L-Bb L-Mj L-Mn 
3qrf X-ray 2.8 N 410-570 None
2o93 X-ray 3.05 O 410-570  H-Bb S-Bb L-Bb L-Mj 
2o93 X-ray 3.05 M 410-570  H-Bb S-Bb L-Bb L-Mj 
2o93 X-ray 3.05 L 410-570  H-Bb S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2019

text