Pfam domain
Pfam family: RHD_dimer (PF16179.4)
Uniprot AC: Q13469
RecName: Nuclear factor of activated T-cells, cytoplasmic 2
Begin-End: 579-678
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb 

Sequence:
MVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNML
FVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
Structures of the domain Q13469 579-678
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1owr X-ray 3 Q 580-677  L-Bb 
1owr X-ray 3 P 580-677  L-Bb 
1owr X-ray 3 N 580-677  L-Bb 
1owr X-ray 3 M 580-677  S-Bb L-Bb 
1pzu X-ray 3.1 M 580-677 None
1pzu X-ray 3.1 L 580-677 None
1pzu X-ray 3.1 H 580-677 None
1pzu X-ray 3.1 I 580-677  L-Bb 
1pzu X-ray 3.1 D 580-677 None
1pzu X-ray 3.1 B 580-677  L-Bb 
1s9k X-ray 3.1 C 580-677 None
1p7h X-ray 2.6 O 580-677 None
1p7h X-ray 2.6 N 580-677  S-Bb L-Bb 
1p7h X-ray 2.6 M 580-677 None
1p7h X-ray 2.6 L 580-677 None
2as5 X-ray 2.7 N 580-677 None
2as5 X-ray 2.7 M 580-677 None
1a02 X-ray 2.7 N 580-677 None
3qrf X-ray 2.8 N 580-677 None
2o93 X-ray 3.05 O 580-677  L-Bb 
2o93 X-ray 3.05 M 580-677 None
2o93 X-ray 3.05 L 580-677  L-Bb 


© NPIDB team 2003 - 2019

text