Pfam domain
Pfam family: UDG (PF03167.21)
Uniprot AC: Q13569
RecName: G/T mismatch-specific thymine DNA glycosylase
Begin-End: 125-295
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 

Sequence:
PDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGK
YGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFG
VKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDL
Structures of the domain Q13569 125-295
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4z3a X-ray 1.72 A 125-295  L-Bb L-Mj L-Mn 
2rba X-ray 2.79 B 125-296  H-Bb L-Bb L-Mn 
2rba X-ray 2.79 A 125-296  H-Bb L-Bb L-Mj L-Mn 
3ufj X-ray 2.97 A 125-296  H-Bb L-Bb L-Mn 
3ufj X-ray 2.97 B 125-296  H-Bb H-Mj L-Bb L-Mj L-Mn 
3ufj X-ray 2.97 B 125-296  H-Bb L-Bb L-Mn 
3ufj X-ray 2.97 A 125-296  H-Bb H-Mj L-Bb L-Mj L-Mn 
6u17 X-ray 1.55 A 125-295  H-Bb H-Mj L-Bb L-Mj L-Mn 
4jgc X-ray 2.58 A 125-296  H-Bb L-Bb L-Mj L-Mn 
5t2w X-ray 2.2 A 125-295  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
4fnc X-ray 2.49 A 125-296  H-Bb L-Bb L-Mj L-Mn 
5cys X-ray 2.45 A 125-296  L-Bb L-Mj L-Mn 
5jxy X-ray 1.71 A 125-296  H-Bb H-Mj L-Bb L-Mj L-Mn 
3uo7 X-ray 3 B 125-300  H-Bb L-Bb 
3uo7 X-ray 3 A 125-296  H-Bb L-Bb L-Mj L-Mn 
3uob X-ray 3.01 A 125-296  H-Bb L-Bb L-Mj L-Mn 
3uob X-ray 3.01 B 125-300  H-Bb L-Bb 
4z7z X-ray 1.83 A 125-296  H-Bb L-Bb L-Mj L-Mn 
5ff8 X-ray 1.7 A 125-296  H-Bb H-Mj L-Bb L-Mj L-Mn 
6u16 X-ray 1.6 A 125-296  H-Bb H-Mj L-Bb L-Mj L-Mn 
6u15 X-ray 2.4 A 125-296  L-Bb L-Mj L-Mn 
5hf7 X-ray 1.54 A 125-295  H-Bb H-Mj L-Bb L-Mj L-Mn 
4xeg X-ray 1.72 A 125-296  H-Bb L-Bb L-Mj L-Mn 
4z7b X-ray 2.02 A 125-296  H-Bb L-Bb L-Mj L-Mn 
4z47 X-ray 1.45 A 125-296  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text