Pfam domain
Pfam family: UDG (PF03167.18)
Uniprot AC: Q13569
RecName: G/T mismatch-specific thymine DNA glycosylase
Begin-End: 125-296
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
PDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGK
YGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFG
VKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLR
Structures of the domain Q13569 125-296
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ff8 X-ray 1.7 A 131-280  H-Bb H-Mj L-Bb L-Mj L-Mn 
4z7b X-ray 2.02 A 131-280  H-Bb L-Bb L-Mj L-Mn 
2rba X-ray 2.79 B 131-280 None
2rba X-ray 2.79 A 131-280  H-Bb S-Bb L-Bb L-Mj L-Mn 
3ufj X-ray 2.97 A 131-280  H-Bb L-Bb L-Mn 
3ufj X-ray 2.97 B 131-280  H-Bb H-Mj L-Bb L-Mj L-Mn 
3ufj X-ray 2.97 B 131-280 None
3ufj X-ray 2.97 A 131-280 None
4jgc X-ray 2.58 A 131-280  H-Bb L-Bb L-Mj L-Mn 
4fnc X-ray 2.49 A 131-280  H-Bb L-Bb L-Mj L-Mn 
3uo7 X-ray 3 B 131-286  H-Bb L-Bb 
3uo7 X-ray 3 A 131-280  L-Bb L-Mj L-Mn 
3uob X-ray 3.01 A 131-280  L-Bb L-Mj L-Mn 
3uob X-ray 3.01 B 131-288  H-Bb L-Bb 
5hf7 X-ray 1.54 A 131-280  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
5jxy X-ray 1.71 A 131-280  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4xeg X-ray 1.72 A 131-280  H-Bb L-Bb L-Mj L-Mn 
5t2w X-ray 2.2 A 131-280  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4z3a X-ray 1.72 A 131-280  L-Bb L-Mj L-Mn 
5cys X-ray 2.45 A 131-280  L-Bb L-Mj L-Mn 
4z47 X-ray 1.45 A 131-280  H-Bb H-Mj L-Bb L-Mj L-Mn 
4z7z X-ray 1.83 A 131-280  H-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text