Pfam domain
Pfam family: Ssl1 (PF04056.13)
Uniprot AC: Q13888
RecName: General transcription factor IIH subunit 2
Begin-End: 64-241
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGN
PRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIY
DLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPA
Structures of the domain Q13888 64-241
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 0 64-241 None
5iy8 X-ray 7.9 0 64-241 None
5ivw X-ray 10 0 64-241 None
5iy6 X-ray 7.2 0 64-241 None
5iy9 X-ray 6.3 0 64-241 None


© NPIDB team 2003 - 2019

text