Pfam domain
Pfam family: Tfb4 (PF03850.13)
Uniprot AC: Q13889
RecName: General transcription factor IIH subunit 3
Begin-End: 8-231
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQES
RFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQ
HTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQ
NILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVF
Structures of the domain Q13889 8-231
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 3 100-231 None
5iy8 X-ray 7.9 3 100-231 None
5ivw X-ray 10 3 100-231 None
5iy6 X-ray 7.2 3 100-231 None
5iy9 X-ray 6.3 3 100-231 None


© NPIDB team 2003 - 2019

text