Pfam domain
Pfam family: E2F_TDP (PF02319.19)
Uniprot AC: Q14188
RecName: Transcription factor Dp-2
Begin-End: 129-208
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
GKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDAL
NVLMAMNIISKEKKEIKWIG
Structures of the domain Q14188 129-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1cf7 X-ray 2.6 B 69-147  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text