Pfam domain
Pfam family: SMC_hinge (PF06470.15)
Uniprot AC: Q14683
RecName: Structural maintenance of chromosomes protein 1A
Begin-End: 512-629
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFL
PLDYLEVKPTDEKLRELKGAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIA
Structures of the domain Q14683 512-629
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wg3 X-ray 5.3 A 512-629 None
6wg6 X-ray 3.54 K 512-629 None
6wg6 X-ray 3.54 A 512-629 None
6wg6 X-ray 3.54 I 512-629 None
6wg6 X-ray 3.54 C 512-629 None


© NPIDB team 2003 - 2021

text