Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: Q14863
RecName: POU domain, class 6, transcription factor 1
Begin-End: 235-287
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
RKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQ
Structures of the domain Q14863 235-287
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3d1n X-ray 2.51 L 235-287  H-Bb 
3d1n X-ray 2.51 K 235-291  H-Bb H-Mj L-Bb L-Mn 
3d1n X-ray 2.51 I 235-291  H-Bb H-Mj L-Bb L-Mn 
3d1n X-ray 2.51 O 235-291  H-Bb H-Mj L-Bb L-Mn 
3d1n X-ray 2.51 M 235-291  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text