Pfam domain
Pfam family: Bac_DNA_binding (PF00216.23)
Uniprot AC: Q14F22
RecName: Integration host factor subunit beta
Begin-End: 1-91
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRT
GRNPKTGDKVELEGKYVPHFKPGKELRDRAN
Structures of the domain Q14F22 1-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ht0 X-ray 2 B 1-91 None


© NPIDB team 2003 - 2021

text